PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0462790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Dof
Protein Properties Length: 350aa    MW: 37692.4 Da    PI: 8.3212
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0462790.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-3949108261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +++al+cprCdstntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk++
  Lj4g3v0462790.1  49 QQQALNCPRCDSTNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRV 108
                      57899****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-3351107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.48853107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2555107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MLGNCDKTAS NKWTQNMNDH HHHQVSTTMG STSSIRAMEK PGQELLQLQQ QALNCPRCDS  60
TNTKFCYYNN YSLSQPRHFC KACKRYWTRG GTLRNVPVGG GCRKNKRVIK RPTGSSTIDS  120
SPSPISSNSN PPSSNPQTTT TSQINPLFFG LPGGGSDVMN LQFPRFNSRV LSGDGGLGSG  180
SGSGFDLLQP QMNNTLGFIS GEVNDNCYRN NNGFSSNNNN SNNTLVSSYS SMFGNSSPSN  240
PVMASLLSST LRQQKFNAFQ GMVPFEQIES DEGGVVAASK EVKVEGQKWN NNNDNGSGGD  300
GGGLCQNQID QHVGLSDPSL YWNNNNNTAM GLGGWSDQVS NIGPSVTSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505077.11e-88PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0K8K6498e-86A0A0K8K649_CAJCA; Dof protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.24e-32Dof family protein